Pay in 4 interest-free payments of $81.94 Learn more
Ships within 48 hours · Estimated delivery Aug 15 - Aug 20
Specificity: IRF2BP2 Antibody detects endogenous levels of total IRF2BP2
Immunogen: A synthesized peptide derived from human HSD17B1
Is unsuitable for MOUSE and RAT
QLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
Dengue virus Type IV Nonstructural Protein 1（DENV4-NS1） - NCP0152 FREE Instrument Specificity: IRF2BP2 Antibody detects endogenousDengue virus Type IV Nonstructural Protein 1DENV4 NS1 Catalogue Number: NCP0152 Product: Inclusion body; 0. 5mol Urea,PH=8 Swiss Prot: M14931. 2 Host: His tag Reactivity: E. coli Expression Applications: Reseach All Applications: Reseach Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS PAGE). Storage and Stability: Store at 4C short term.
US$ 62.00
US$ 60.00
US$ 38.00